Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,798
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,297
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,050
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,903
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,839
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,778
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,754
  8. Avatar for Kentridge Biotech 18. Kentridge Biotech 1 pt. 7,931
  1. Avatar for 181818 81. 181818 Lv 1 3 pts. 9,501
  2. Avatar for dizzywings 82. dizzywings Lv 1 3 pts. 9,499
  3. Avatar for jamiexq 83. jamiexq Lv 1 3 pts. 9,458
  4. Avatar for hanyanbo98 84. hanyanbo98 Lv 1 3 pts. 9,412
  5. Avatar for Superphosphate 85. Superphosphate Lv 1 3 pts. 9,385
  6. Avatar for Vincera 86. Vincera Lv 1 2 pts. 9,385
  7. Avatar for FishKAA 87. FishKAA Lv 1 2 pts. 9,381
  8. Avatar for micheldeweerd 88. micheldeweerd Lv 1 2 pts. 9,379
  9. Avatar for Alistair69 89. Alistair69 Lv 1 2 pts. 9,333
  10. Avatar for leehaggis 90. leehaggis Lv 1 2 pts. 9,308

Comments