Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Go Science 100 pts. 10,913
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,536
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,514
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,456
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 10,430
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,423
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 10,400
  8. Avatar for Contenders 8. Contenders 8 pts. 10,360
  9. Avatar for Deleted group 9. Deleted group pts. 10,038
  10. Avatar for Russian team 10. Russian team 3 pts. 9,890

  1. Avatar for C_Elegans 121. C_Elegans Lv 1 1 pt. 9,011
  2. Avatar for Arne Heessels 122. Arne Heessels Lv 1 1 pt. 8,980
  3. Avatar for realparr0 123. realparr0 Lv 1 1 pt. 8,951
  4. Avatar for Prion_8 124. Prion_8 Lv 1 1 pt. 8,943
  5. Avatar for parsnip 125. parsnip Lv 1 1 pt. 8,940
  6. Avatar for Pibeagles 126. Pibeagles Lv 1 1 pt. 8,928
  7. Avatar for NotJim99 127. NotJim99 Lv 1 1 pt. 8,915
  8. Avatar for Ricardo Oliveira 128. Ricardo Oliveira Lv 1 1 pt. 8,914
  9. Avatar for emtonsti 129. emtonsti Lv 1 1 pt. 8,906
  10. Avatar for aspadistra 130. aspadistra Lv 1 1 pt. 8,903

Comments