Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Go Science 100 pts. 10,913
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,536
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,514
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,456
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 10,430
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,423
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 10,400
  8. Avatar for Contenders 8. Contenders 8 pts. 10,360
  9. Avatar for Deleted group 9. Deleted group pts. 10,038
  10. Avatar for Russian team 10. Russian team 3 pts. 9,890

  1. Avatar for gulsahsimsir 141. gulsahsimsir Lv 1 1 pt. 8,758
  2. Avatar for alyssa_d 142. alyssa_d Lv 1 1 pt. 8,754
  3. Avatar for lamoille 143. lamoille Lv 1 1 pt. 8,750
  4. Avatar for 402-Ri_Fed 144. 402-Ri_Fed Lv 1 1 pt. 8,663
  5. Avatar for tigerdwgth 145. tigerdwgth Lv 1 1 pt. 8,379
  6. Avatar for claudiu.avram 146. claudiu.avram Lv 1 1 pt. 8,353
  7. Avatar for sendasticloop 147. sendasticloop Lv 1 1 pt. 8,233
  8. Avatar for 01010011111 148. 01010011111 Lv 1 1 pt. 8,055
  9. Avatar for Dilara Caliskur 149. Dilara Caliskur Lv 1 1 pt. 8,039
  10. Avatar for P-51 Mustang 150. P-51 Mustang Lv 1 1 pt. 8,028

Comments