Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Go Science 100 pts. 10,913
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,536
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,514
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,456
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 10,430
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,423
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 10,400
  8. Avatar for Contenders 8. Contenders 8 pts. 10,360
  9. Avatar for Deleted group 9. Deleted group pts. 10,038
  10. Avatar for Russian team 10. Russian team 3 pts. 9,890

  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 23 pts. 10,155
  2. Avatar for jobo0502 42. jobo0502 Lv 1 22 pts. 10,154
  3. Avatar for Vinara 43. Vinara Lv 1 21 pts. 10,152
  4. Avatar for Idiotboy 44. Idiotboy Lv 1 20 pts. 10,145
  5. Avatar for YeshuaLives 45. YeshuaLives Lv 1 19 pts. 10,105
  6. Avatar for diamonddays 46. diamonddays Lv 1 19 pts. 10,104
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 18 pts. 10,096
  8. Avatar for isaksson 48. isaksson Lv 1 17 pts. 10,091
  9. Avatar for jausmh 49. jausmh Lv 1 16 pts. 10,075
  10. Avatar for MicElephant 50. MicElephant Lv 1 15 pts. 10,057

Comments