Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Go Science 100 pts. 10,913
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,536
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,514
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,456
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 10,430
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,423
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 10,400
  8. Avatar for Contenders 8. Contenders 8 pts. 10,360
  9. Avatar for Deleted group 9. Deleted group pts. 10,038
  10. Avatar for Russian team 10. Russian team 3 pts. 9,890

  1. Avatar for georg137 51. georg137 Lv 1 15 pts. 10,053
  2. Avatar for robgee 52. robgee Lv 1 14 pts. 10,051
  3. Avatar for fpc 53. fpc Lv 1 13 pts. 10,049
  4. Avatar for tarimo 54. tarimo Lv 1 13 pts. 10,048
  5. Avatar for Sissue 55. Sissue Lv 1 12 pts. 10,038
  6. Avatar for smilingone 56. smilingone Lv 1 12 pts. 10,034
  7. Avatar for katling 57. katling Lv 1 11 pts. 10,028
  8. Avatar for alwen 58. alwen Lv 1 11 pts. 10,026
  9. Avatar for andrewxc 59. andrewxc Lv 1 10 pts. 9,986
  10. Avatar for dbuske 60. dbuske Lv 1 10 pts. 9,982

Comments