Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 3 pts. 8,854
  2. Avatar for GENE 433 12. GENE 433 2 pts. 8,590
  3. Avatar for Wheaton College Biochemistry 13. Wheaton College Biochemistry 1 pt. 8,239
  4. Avatar for Deleted group 14. Deleted group pts. 7,952
  5. Avatar for PM/01/2018 15. PM/01/2018 1 pt. 7,352
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 7,079
  7. Avatar for KNBIBS@MIMUW 17. KNBIBS@MIMUW 1 pt. 6,451
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,253
  9. Avatar for Deleted group 19. Deleted group pts. 6,024
  10. Avatar for HMT heritage 20. HMT heritage 1 pt. 0
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,550
  2. Avatar for grogar7 2. grogar7 Lv 1 82 pts. 9,542
  3. Avatar for phi16 3. phi16 Lv 1 66 pts. 9,536
  4. Avatar for lamoille 4. lamoille Lv 1 53 pts. 9,529
  5. Avatar for alwen 5. alwen Lv 1 42 pts. 9,526
  6. Avatar for Deleted player 6. Deleted player pts. 9,518
  7. Avatar for alcor29 7. alcor29 Lv 1 26 pts. 9,516
  8. Avatar for drjr 8. drjr Lv 1 20 pts. 9,514
  9. Avatar for andrewxc 9. andrewxc Lv 1 15 pts. 9,504
  10. Avatar for keithv 10. keithv Lv 1 11 pts. 9,502

Comments