Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 3 pts. 8,854
  2. Avatar for GENE 433 12. GENE 433 2 pts. 8,590
  3. Avatar for Wheaton College Biochemistry 13. Wheaton College Biochemistry 1 pt. 8,239
  4. Avatar for Deleted group 14. Deleted group pts. 7,952
  5. Avatar for PM/01/2018 15. PM/01/2018 1 pt. 7,352
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 7,079
  7. Avatar for KNBIBS@MIMUW 17. KNBIBS@MIMUW 1 pt. 6,451
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,253
  9. Avatar for Deleted group 19. Deleted group pts. 6,024
  10. Avatar for HMT heritage 20. HMT heritage 1 pt. 0
  1. Avatar for parsnip 111. parsnip Lv 1 1 pt. 8,023
  2. Avatar for smais 112. smais Lv 1 1 pt. 7,977
  3. Avatar for rinze 113. rinze Lv 1 1 pt. 7,963
  4. Avatar for bps_cacchione_2017 114. bps_cacchione_2017 Lv 1 1 pt. 7,952
  5. Avatar for bcre8tvv 115. bcre8tvv Lv 1 1 pt. 7,896
  6. Avatar for Graham MF 116. Graham MF Lv 1 1 pt. 7,862
  7. Avatar for rolfpf 117. rolfpf Lv 1 1 pt. 7,757
  8. Avatar for Louis_LIB 118. Louis_LIB Lv 1 1 pt. 7,741
  9. Avatar for dataco79 119. dataco79 Lv 1 1 pt. 7,713
  10. Avatar for Wheeler22 120. Wheeler22 Lv 1 1 pt. 7,482

Comments