Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 3 pts. 8,854
  2. Avatar for GENE 433 12. GENE 433 2 pts. 8,590
  3. Avatar for Deleted group 14. Deleted group pts. 7,952
  4. Avatar for PM/01/2018 15. PM/01/2018 1 pt. 7,352
  5. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 7,079
  6. Avatar for KNBIBS@MIMUW 17. KNBIBS@MIMUW 1 pt. 6,451
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,253
  8. Avatar for Deleted group 19. Deleted group pts. 6,024
  9. Avatar for HMT heritage 20. HMT heritage 1 pt. 0

  1. Avatar for pfunston 151. pfunston Lv 1 1 pt. 4,365
  2. Avatar for kilars 152. kilars Lv 1 1 pt. 4,254
  3. Avatar for mckeown2010 153. mckeown2010 Lv 1 1 pt. 2,547
  4. Avatar for phi16 154. phi16 Lv 1 1 pt. 2,008
  5. Avatar for PiotrJ1337 155. PiotrJ1337 Lv 1 1 pt. 0
  6. Avatar for beckhalo 156. beckhalo Lv 1 1 pt. 0
  7. Avatar for lamoille 157. lamoille Lv 1 1 pt. 0
  8. Avatar for histon 158. histon Lv 1 1 pt. 0
  9. Avatar for Hollinas 159. Hollinas Lv 1 1 pt. 0
  10. Avatar for mimi 160. mimi Lv 1 1 pt. 0

Comments