Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,550
  2. Avatar for grogar7 2. grogar7 Lv 1 82 pts. 9,542
  3. Avatar for phi16 3. phi16 Lv 1 66 pts. 9,536
  4. Avatar for lamoille 4. lamoille Lv 1 53 pts. 9,529
  5. Avatar for alwen 5. alwen Lv 1 42 pts. 9,526
  6. Avatar for Deleted player 6. Deleted player pts. 9,518
  7. Avatar for alcor29 7. alcor29 Lv 1 26 pts. 9,516
  8. Avatar for drjr 8. drjr Lv 1 20 pts. 9,514
  9. Avatar for andrewxc 9. andrewxc Lv 1 15 pts. 9,504
  10. Avatar for keithv 10. keithv Lv 1 11 pts. 9,502

Comments