Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023
  1. Avatar for Keresto 11. Keresto Lv 1 8 pts. 9,497
  2. Avatar for Blipperman 12. Blipperman Lv 1 6 pts. 9,497
  3. Avatar for Hollinas 13. Hollinas Lv 1 4 pts. 9,398
  4. Avatar for Azukay 14. Azukay Lv 1 3 pts. 9,398
  5. Avatar for jeff101 15. jeff101 Lv 1 2 pts. 9,398
  6. Avatar for Maerlyn138 16. Maerlyn138 Lv 1 2 pts. 9,397
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 1 pt. 9,396
  8. Avatar for toshiue 18. toshiue Lv 1 1 pt. 9,395
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 1 pt. 9,388
  10. Avatar for actiasluna 20. actiasluna Lv 1 1 pt. 9,380

Comments