Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023
  1. Avatar for anthion 21. anthion Lv 1 52 pts. 9,251
  2. Avatar for Blipperman 22. Blipperman Lv 1 51 pts. 9,237
  3. Avatar for reefyrob 23. reefyrob Lv 1 49 pts. 9,234
  4. Avatar for nicobul 24. nicobul Lv 1 47 pts. 9,232
  5. Avatar for pauldunn 25. pauldunn Lv 1 46 pts. 9,225
  6. Avatar for Timo van der Laan 26. Timo van der Laan Lv 1 44 pts. 9,218
  7. Avatar for ComputerMage 27. ComputerMage Lv 1 42 pts. 9,217
  8. Avatar for Deleted player 28. Deleted player pts. 9,214
  9. Avatar for dcrwheeler 29. dcrwheeler Lv 1 39 pts. 9,195
  10. Avatar for crpainter 30. crpainter Lv 1 38 pts. 9,187

Comments