Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023

  1. Avatar for Skippysk8s 31. Skippysk8s Lv 1 37 pts. 9,169
  2. Avatar for Tehnologik1 32. Tehnologik1 Lv 1 35 pts. 9,139
  3. Avatar for YeshuaLives 33. YeshuaLives Lv 1 34 pts. 9,133
  4. Avatar for Mike Cassidy 34. Mike Cassidy Lv 1 33 pts. 9,130
  5. Avatar for pvc78 35. pvc78 Lv 1 32 pts. 9,121
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 30 pts. 9,102
  7. Avatar for guineapig 37. guineapig Lv 1 29 pts. 9,100
  8. Avatar for Threeoak 38. Threeoak Lv 1 28 pts. 9,098
  9. Avatar for tarimo 39. tarimo Lv 1 27 pts. 9,098
  10. Avatar for alcor29 40. alcor29 Lv 1 26 pts. 9,080

Comments