Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 8,944
  2. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  4. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  5. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  6. Avatar for OmHS 16. OmHS 1 pt. 7,544
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,750
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 98 pts. 9,705
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 95 pts. 9,692
  4. Avatar for Enzyme 4. Enzyme Lv 1 92 pts. 9,691
  5. Avatar for frood66 5. frood66 Lv 1 89 pts. 9,668
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 86 pts. 9,667
  7. Avatar for reefyrob 7. reefyrob Lv 1 84 pts. 9,658
  8. Avatar for eusair 8. eusair Lv 1 81 pts. 9,649
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 79 pts. 9,636
  10. Avatar for Galaxie 10. Galaxie Lv 1 76 pts. 9,629

Comments