Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,773
  2. Avatar for Contenders 2. Contenders 71 pts. 9,692
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,691
  4. Avatar for Go Science 4. Go Science 33 pts. 9,668
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 9,668
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,629
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,610
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,592
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,384
  10. Avatar for GENE 433 10. GENE 433 2 pts. 9,119

  1. Avatar for leehaggis 91. leehaggis Lv 1 3 pts. 9,004
  2. Avatar for FishKAA 92. FishKAA Lv 1 2 pts. 8,998
  3. Avatar for rezaefar 93. rezaefar Lv 1 2 pts. 8,984
  4. Avatar for pfirth 94. pfirth Lv 1 2 pts. 8,967
  5. Avatar for Graham MF 95. Graham MF Lv 1 2 pts. 8,965
  6. Avatar for abiogenesis 96. abiogenesis Lv 1 2 pts. 8,955
  7. Avatar for Mike Cassidy 97. Mike Cassidy Lv 1 2 pts. 8,954
  8. Avatar for nathanmills 98. nathanmills Lv 1 2 pts. 8,944
  9. Avatar for RootBeerSwordsman 99. RootBeerSwordsman Lv 1 2 pts. 8,943
  10. Avatar for 181818 100. 181818 Lv 1 2 pts. 8,942

Comments