Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,773
  2. Avatar for Contenders 2. Contenders 71 pts. 9,692
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,691
  4. Avatar for Go Science 4. Go Science 33 pts. 9,668
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 9,668
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,629
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,610
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,592
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,384
  10. Avatar for GENE 433 10. GENE 433 2 pts. 9,119

  1. Avatar for keithv 101. keithv Lv 1 1 pt. 8,935
  2. Avatar for Vincera 102. Vincera Lv 1 1 pt. 8,892
  3. Avatar for benrh 103. benrh Lv 1 1 pt. 8,890
  4. Avatar for Deleted player 104. Deleted player 1 pt. 8,878
  5. Avatar for jamiexq 105. jamiexq Lv 1 1 pt. 8,858
  6. Avatar for martinf 106. martinf Lv 1 1 pt. 8,848
  7. Avatar for hada 107. hada Lv 1 1 pt. 8,838
  8. Avatar for Acida-2 108. Acida-2 Lv 1 1 pt. 8,837
  9. Avatar for rabamino12358 109. rabamino12358 Lv 1 1 pt. 8,837
  10. Avatar for gstelle 110. gstelle Lv 1 1 pt. 8,826

Comments