Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,773
  2. Avatar for Contenders 2. Contenders 71 pts. 9,692
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,691
  4. Avatar for Go Science 4. Go Science 33 pts. 9,668
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 9,668
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,629
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,610
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,592
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,384
  10. Avatar for GENE 433 10. GENE 433 2 pts. 9,119

  1. Avatar for jmwallach 151. jmwallach Lv 1 1 pt. 7,721
  2. Avatar for JCBio162 152. JCBio162 Lv 1 1 pt. 7,667
  3. Avatar for ahamplanet 153. ahamplanet Lv 1 1 pt. 7,580
  4. Avatar for 01010011111 154. 01010011111 Lv 1 1 pt. 7,568
  5. Avatar for Hollinas 155. Hollinas Lv 1 1 pt. 7,544
  6. Avatar for s-madmessina 156. s-madmessina Lv 1 1 pt. 7,544
  7. Avatar for Susume 157. Susume Lv 1 1 pt. 7,544
  8. Avatar for jeff101 158. jeff101 Lv 1 1 pt. 7,544
  9. Avatar for Negaster 159. Negaster Lv 1 1 pt. 7,544
  10. Avatar for cguccione 160. cguccione Lv 1 1 pt. 7,544

Comments