Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,773
  2. Avatar for Contenders 2. Contenders 71 pts. 9,692
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,691
  4. Avatar for Go Science 4. Go Science 33 pts. 9,668
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 9,668
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,629
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,610
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,592
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,384
  10. Avatar for GENE 433 10. GENE 433 2 pts. 9,119
  1. Avatar for lamoille 131. lamoille Lv 1 1 pt. 8,633
  2. Avatar for Anamfija 132. Anamfija Lv 1 1 pt. 8,629
  3. Avatar for jtedescolec 133. jtedescolec Lv 1 1 pt. 8,620
  4. Avatar for NotJim99 134. NotJim99 Lv 1 1 pt. 8,616
  5. Avatar for MegynC 135. MegynC Lv 1 1 pt. 8,615
  6. Avatar for Jacksonfly 136. Jacksonfly Lv 1 1 pt. 8,600
  7. Avatar for t012 137. t012 Lv 1 1 pt. 8,567
  8. Avatar for The_mad_coder 138. The_mad_coder Lv 1 1 pt. 8,540
  9. Avatar for larry25427 139. larry25427 Lv 1 1 pt. 8,514
  10. Avatar for iON_Q 140. iON_Q Lv 1 1 pt. 8,488

Comments