Placeholder image of a protein
Icon representing a puzzle

1477: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 31, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Minions of TWIS 11. Minions of TWIS 2 pts. 9,526
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 9,387
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 9,360
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,315
  5. Avatar for freefolder 15. freefolder 1 pt. 9,250
  6. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 9,227
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 9,204
  8. Avatar for OmHS 18. OmHS 1 pt. 9,187

  1. Avatar for ViJay7019 61. ViJay7019 Lv 1 10 pts. 9,639
  2. Avatar for Tehnologik1 62. Tehnologik1 Lv 1 9 pts. 9,638
  3. Avatar for Deleted player 63. Deleted player pts. 9,630
  4. Avatar for atlas100 64. atlas100 Lv 1 8 pts. 9,626
  5. Avatar for mitarcher 65. mitarcher Lv 1 8 pts. 9,611
  6. Avatar for hansvandenhof 66. hansvandenhof Lv 1 7 pts. 9,610
  7. Avatar for FishKAA 67. FishKAA Lv 1 7 pts. 9,606
  8. Avatar for ppp6 68. ppp6 Lv 1 7 pts. 9,602
  9. Avatar for alwen 70. alwen Lv 1 6 pts. 9,598

Comments