Placeholder image of a protein
Icon representing a puzzle

1477: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 31, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,960
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,912
  3. Avatar for Marvin's bunch 3. Marvin's bunch 54 pts. 9,896
  4. Avatar for Go Science 4. Go Science 38 pts. 9,864
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,849
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,828
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,811
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,806
  9. Avatar for Contenders 9. Contenders 5 pts. 9,771
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,665

  1. Avatar for SKSbell 51. SKSbell Lv 1 15 pts. 9,672
  2. Avatar for andrewxc 52. andrewxc Lv 1 15 pts. 9,671
  3. Avatar for dizzywings 53. dizzywings Lv 1 14 pts. 9,667
  4. Avatar for pmthomson90 54. pmthomson90 Lv 1 13 pts. 9,665
  5. Avatar for Flagg65a 55. Flagg65a Lv 1 13 pts. 9,658
  6. Avatar for kyky 56. kyky Lv 1 12 pts. 9,657
  7. Avatar for Vinara 57. Vinara Lv 1 12 pts. 9,657
  8. Avatar for SaraL 58. SaraL Lv 1 11 pts. 9,649
  9. Avatar for Anfinsen_slept_here 59. Anfinsen_slept_here Lv 1 10 pts. 9,646
  10. Avatar for Azukay 60. Azukay Lv 1 10 pts. 9,645

Comments