Placeholder image of a protein
Icon representing a puzzle

1477: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 31, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,960
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,912
  3. Avatar for Marvin's bunch 3. Marvin's bunch 54 pts. 9,896
  4. Avatar for Go Science 4. Go Science 38 pts. 9,864
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,849
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,828
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,811
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,806
  9. Avatar for Contenders 9. Contenders 5 pts. 9,771
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,665

  1. Avatar for isaksson 71. isaksson Lv 1 6 pts. 9,596
  2. Avatar for Glen B 72. Glen B Lv 1 5 pts. 9,591
  3. Avatar for Deleted player 73. Deleted player pts. 9,589
  4. Avatar for tarimo 74. tarimo Lv 1 5 pts. 9,585
  5. Avatar for manu8170 75. manu8170 Lv 1 5 pts. 9,576
  6. Avatar for leehaggis 76. leehaggis Lv 1 4 pts. 9,574
  7. Avatar for Maerlyn138 77. Maerlyn138 Lv 1 4 pts. 9,567
  8. Avatar for fishercat 78. fishercat Lv 1 4 pts. 9,566
  9. Avatar for rezaefar 79. rezaefar Lv 1 4 pts. 9,564
  10. Avatar for pandapharmd 80. pandapharmd Lv 1 4 pts. 9,559

Comments