Placeholder image of a protein
Icon representing a puzzle

1477: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 31, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,960
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,912
  3. Avatar for Marvin's bunch 3. Marvin's bunch 54 pts. 9,896
  4. Avatar for Go Science 4. Go Science 38 pts. 9,864
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,849
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,828
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,811
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,806
  9. Avatar for Contenders 9. Contenders 5 pts. 9,771
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,665

  1. Avatar for pietro.willi 81. pietro.willi Lv 1 3 pts. 9,556
  2. Avatar for harvardman 82. harvardman Lv 1 3 pts. 9,555
  3. Avatar for hada 83. hada Lv 1 3 pts. 9,552
  4. Avatar for froggs554 84. froggs554 Lv 1 3 pts. 9,550
  5. Avatar for altejoh 85. altejoh Lv 1 3 pts. 9,541
  6. Avatar for Amphimixus 86. Amphimixus Lv 1 3 pts. 9,536
  7. Avatar for TastyMunchies 87. TastyMunchies Lv 1 2 pts. 9,531
  8. Avatar for RootBeerSwordsman 88. RootBeerSwordsman Lv 1 2 pts. 9,530
  9. Avatar for gldisater 89. gldisater Lv 1 2 pts. 9,526
  10. Avatar for roman madala 90. roman madala Lv 1 2 pts. 9,505

Comments