Placeholder image of a protein
Icon representing a puzzle

1477: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,960
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,912
  3. Avatar for Marvin's bunch 3. Marvin's bunch 54 pts. 9,896
  4. Avatar for Go Science 4. Go Science 38 pts. 9,864
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,849
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,828
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,811
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,806
  9. Avatar for Contenders 9. Contenders 5 pts. 9,771
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,665
  1. Avatar for flemdogmillionaire 91. flemdogmillionaire Lv 1 2 pts. 9,501
  2. Avatar for benrh 92. benrh Lv 1 2 pts. 9,487
  3. Avatar for Pibeagles 93. Pibeagles Lv 1 2 pts. 9,483
  4. Avatar for NinjaGreg 94. NinjaGreg Lv 1 2 pts. 9,479
  5. Avatar for senor pit 95. senor pit Lv 1 2 pts. 9,472
  6. Avatar for martinf 96. martinf Lv 1 1 pt. 9,469
  7. Avatar for Arne Heessels 97. Arne Heessels Lv 1 1 pt. 9,460
  8. Avatar for tamanrasset 98. tamanrasset Lv 1 1 pt. 9,455
  9. Avatar for sciencewalker 99. sciencewalker Lv 1 1 pt. 9,454
  10. Avatar for FractalCuber 100. FractalCuber Lv 1 1 pt. 9,453

Comments