Placeholder image of a protein
Icon representing a puzzle

1477: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 31, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,960
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,912
  3. Avatar for Marvin's bunch 3. Marvin's bunch 54 pts. 9,896
  4. Avatar for Go Science 4. Go Science 38 pts. 9,864
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,849
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,828
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,811
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,806
  9. Avatar for Contenders 9. Contenders 5 pts. 9,771
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,665

  1. Avatar for jausmh 41. jausmh Lv 1 23 pts. 9,704
  2. Avatar for fpc 42. fpc Lv 1 23 pts. 9,703
  3. Avatar for diamonddays 43. diamonddays Lv 1 22 pts. 9,702
  4. Avatar for toshiue 44. toshiue Lv 1 21 pts. 9,696
  5. Avatar for fiendish_ghoul 45. fiendish_ghoul Lv 1 20 pts. 9,696
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 19 pts. 9,696
  7. Avatar for SouperGenious 47. SouperGenious Lv 1 18 pts. 9,691
  8. Avatar for guineapig 48. guineapig Lv 1 17 pts. 9,682
  9. Avatar for caglar 49. caglar Lv 1 17 pts. 9,681
  10. Avatar for katling 50. katling Lv 1 16 pts. 9,673

Comments