jeff101 Lv 1
Can we load solutions from puzzle 1475 into puzzle 1478?
Closed since about 8 years ago
Intermediate IntermediateNote: This puzzle will crash Foldit on Linux operating systems, due to a known bug related to electron density. For this reason, the puzzle is worth 0 points, and players should not feel compelled to play this puzzle to remain competitive on the leaderboards. Nevertheless, we are quite invested in this protein, and would appreciate any help from Foldit players to build a better model into this electron density map!
This is a followup to Puzzle 1475. We've been able to purify and crystallize this protein, which was designed by tokens in Puzzle 1313. The protein crystal diffracts x-rays to a resolution of 1.9 Å, and we've been able to derive an electron density map for the crystal. We think we have a pretty good idea of this protein's structure from the electron density, but some data analysis suggests our model could be improved. We want to know if Foldit players can build a better model into the electron density!
In the crystal, this protein comes together in two unique orientations. This is one half of the electron density map, with the protein in the second orientation. In Puzzle 1452 we challenged players to predict the structure of this protein from sequence alone. Players may load in solutions from Puzzle 1452 to see how well their predictions fit in the electron density map.
Can we load solutions from puzzle 1475 into puzzle 1478?
While the correct models for puzzles 1475 and 1478 are likely very similar, they will be distinct.
We want to encourage players to build models directly into this density map, rather than try to force in models that was previously built with another density map.
Sequence:
TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK
I am re-posting the amino acid sequence here for the sake of convenience. Will save you a click or two.