Placeholder image of a protein
Icon representing a puzzle

1478: Foldit Player Design with Electron Density: Part 2

Closed since about 8 years ago

Intermediate

Summary

Created
February 01, 2018
Expires
Max points
100
Description

Note: This puzzle will crash Foldit on Linux operating systems, due to a known bug related to electron density. For this reason, the puzzle is worth 0 points, and players should not feel compelled to play this puzzle to remain competitive on the leaderboards. Nevertheless, we are quite invested in this protein, and would appreciate any help from Foldit players to build a better model into this electron density map!



This is a followup to Puzzle 1475. We've been able to purify and crystallize this protein, which was designed by tokens in Puzzle 1313. The protein crystal diffracts x-rays to a resolution of 1.9 Å, and we've been able to derive an electron density map for the crystal. We think we have a pretty good idea of this protein's structure from the electron density, but some data analysis suggests our model could be improved. We want to know if Foldit players can build a better model into the electron density!



In the crystal, this protein comes together in two unique orientations. This is one half of the electron density map, with the protein in the second orientation. In Puzzle 1452 we challenged players to predict the structure of this protein from sequence alone. Players may load in solutions from Puzzle 1452 to see how well their predictions fit in the electron density map.

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,392
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,379
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 12,368
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 12,351
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 12,263
  6. Avatar for Eastern Prehistoric Force 6. Eastern Prehistoric Force 14 pts. 11,816
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 11,736
  8. Avatar for Contenders 8. Contenders 5 pts. 11,246
  9. Avatar for freefolder 9. freefolder 3 pts. 10,547
  10. Avatar for HMT heritage 10. HMT heritage 2 pts. 9,915
  1. Avatar for Vinara 41. Vinara Lv 1 20 pts. 10,565
  2. Avatar for Altercomp 42. Altercomp Lv 1 19 pts. 10,547
  3. Avatar for guineapig 43. guineapig Lv 1 18 pts. 10,529
  4. Avatar for altejoh 44. altejoh Lv 1 17 pts. 10,426
  5. Avatar for WBarme1234 45. WBarme1234 Lv 1 17 pts. 10,308
  6. Avatar for hpaege 46. hpaege Lv 1 16 pts. 10,236
  7. Avatar for Threeoak 47. Threeoak Lv 1 15 pts. 10,218
  8. Avatar for YeshuaLives 48. YeshuaLives Lv 1 14 pts. 10,203
  9. Avatar for Mike Cassidy 49. Mike Cassidy Lv 1 14 pts. 10,095
  10. Avatar for georg137 50. georg137 Lv 1 13 pts. 10,082

Comments

bkoep Staff Lv 1

While the correct models for puzzles 1475 and 1478 are likely very similar, they will be distinct.

We want to encourage players to build models directly into this density map, rather than try to force in models that was previously built with another density map.

Anfinsen_slept_here Lv 1

Sequence:
TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

I am re-posting the amino acid sequence here for the sake of convenience. Will save you a click or two.