Placeholder image of a protein
Icon representing a puzzle

1480: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 07, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,475
  2. Avatar for freefolder 12. freefolder 1 pt. 9,222
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,191
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,049
  5. Avatar for Deleted group 15. Deleted group pts. 8,946
  6. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 8,899
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,875
  8. Avatar for CSE162 18. CSE162 1 pt. 8,215
  9. Avatar for :) 19. :) 1 pt. 8,085
  1. Avatar for beau1023 91. beau1023 Lv 1 2 pts. 9,371
  2. Avatar for frostschutz 92. frostschutz Lv 1 2 pts. 9,367
  3. Avatar for hada 93. hada Lv 1 2 pts. 9,355
  4. Avatar for atlas100 94. atlas100 Lv 1 2 pts. 9,337
  5. Avatar for joremen 95. joremen Lv 1 2 pts. 9,327
  6. Avatar for adsilvag 96. adsilvag Lv 1 2 pts. 9,318
  7. Avatar for mitarcher 97. mitarcher Lv 1 2 pts. 9,318
  8. Avatar for ferg344 98. ferg344 Lv 1 2 pts. 9,314
  9. Avatar for bblattmann 99. bblattmann Lv 1 2 pts. 9,308
  10. Avatar for Merf 100. Merf Lv 1 1 pt. 9,308

Comments