Placeholder image of a protein
Icon representing a puzzle

1480: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 07, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,475
  2. Avatar for freefolder 12. freefolder 1 pt. 9,222
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,191
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,049
  5. Avatar for Deleted group 15. Deleted group pts. 8,946
  6. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 8,899
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,875
  8. Avatar for CSE162 18. CSE162 1 pt. 8,215
  9. Avatar for :) 19. :) 1 pt. 8,085

  1. Avatar for Amphimixus 151. Amphimixus Lv 1 1 pt. 8,488
  2. Avatar for Puttering 152. Puttering Lv 1 1 pt. 8,480
  3. Avatar for kalachastan 153. kalachastan Lv 1 1 pt. 8,447
  4. Avatar for Lilit Nersisyan 154. Lilit Nersisyan Lv 1 1 pt. 8,215
  5. Avatar for 01010011111 155. 01010011111 Lv 1 1 pt. 8,100
  6. Avatar for Tweedle Dumb 156. Tweedle Dumb Lv 1 1 pt. 8,085
  7. Avatar for machinelves 157. machinelves Lv 1 1 pt. 8,085
  8. Avatar for matosfran 158. matosfran Lv 1 1 pt. 8,085
  9. Avatar for mridulkaimal 159. mridulkaimal Lv 1 1 pt. 8,085
  10. Avatar for tokens 160. tokens Lv 1 1 pt. 8,085

Comments