Placeholder image of a protein
Icon representing a puzzle

1480: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 07, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,475
  2. Avatar for freefolder 12. freefolder 1 pt. 9,222
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,191
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,049
  5. Avatar for Deleted group 15. Deleted group pts. 8,946
  6. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 8,899
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,875
  8. Avatar for CSE162 18. CSE162 1 pt. 8,215
  9. Avatar for :) 19. :) 1 pt. 8,085

  1. Avatar for Idiotboy 41. Idiotboy Lv 1 25 pts. 9,762
  2. Avatar for Deleted player 42. Deleted player pts. 9,760
  3. Avatar for SaraL 43. SaraL Lv 1 23 pts. 9,755
  4. Avatar for caglar 44. caglar Lv 1 22 pts. 9,751
  5. Avatar for guineapig 45. guineapig Lv 1 21 pts. 9,743
  6. Avatar for diamonddays 46. diamonddays Lv 1 20 pts. 9,740
  7. Avatar for Sissue 47. Sissue Lv 1 20 pts. 9,736
  8. Avatar for altejoh 48. altejoh Lv 1 19 pts. 9,725
  9. Avatar for Flagg65a 49. Flagg65a Lv 1 18 pts. 9,723
  10. Avatar for ViJay7019 50. ViJay7019 Lv 1 17 pts. 9,711

Comments