1480: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 8 years ago

Summary

• Created: February 07, 2018
• Expires: February 14, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

• 1. Beta Folders 100 pts. 10,050
• 2. Anthropic Dreams 76 pts. 10,022
• 3. Go Science 56 pts. 10,013
• 4. Contenders 41 pts. 10,005
• 5. Marvin's bunch 29 pts. 9,992
• 6. Void Crushers 20 pts. 9,937
• 7. Gargleblasters 14 pts. 9,893
• 8. L'Alliance Francophone 9 pts. 9,877
• 9. HMT heritage 6 pts. 9,796
• 10. Eastern Prehistoric Force 4 pts. 9,560

Top evolvers

• 1. LociOiling 100 pts. 10,050
• 2. smilingone 83 pts. 10,045
• 3. reefyrob 69 pts. 10,045
• 4. bertro 56 pts. 10,035
• 5. Galaxie 45 pts. 10,022
• 6. phi16 36 pts. 10,013
• 7. lamoille 29 pts. 10,012
• 8. toshiue 23 pts. 10,011
• 9. Deleted player pts. 10,011
• 10. Hollinas 14 pts. 10,008