Placeholder image of a protein
Icon representing a puzzle

1480: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 07, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Beta Folders 100 pts. 10,050
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,022
  3. Avatar for Go Science 3. Go Science 56 pts. 10,013
  4. Avatar for Contenders 4. Contenders 41 pts. 10,005
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 9,992
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,937
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,893
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 9,877
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,796

  1. Avatar for DoctorSockrates 81. DoctorSockrates Lv 1 4 pts. 9,417
  2. Avatar for sharondipity 82. sharondipity Lv 1 4 pts. 9,409
  3. Avatar for SouperGenious 83. SouperGenious Lv 1 4 pts. 9,407
  4. Avatar for xabxs 84. xabxs Lv 1 3 pts. 9,405
  5. Avatar for kyky 85. kyky Lv 1 3 pts. 9,404
  6. Avatar for rezaefar 86. rezaefar Lv 1 3 pts. 9,401
  7. Avatar for FishKAA 87. FishKAA Lv 1 3 pts. 9,401
  8. Avatar for froggs554 89. froggs554 Lv 1 3 pts. 9,391
  9. Avatar for ppp6 90. ppp6 Lv 1 2 pts. 9,383

Comments