Placeholder image of a protein
Icon representing a puzzle

1480: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 07, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,050
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,022
  3. Avatar for Go Science 3. Go Science 56 pts. 10,013
  4. Avatar for Contenders 4. Contenders 41 pts. 10,005
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 9,992
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,937
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,893
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 9,877
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,796
  10. Avatar for Eastern Prehistoric Force 10. Eastern Prehistoric Force 4 pts. 9,560
  1. Avatar for jbmkfm125 161. jbmkfm125 Lv 1 1 pt. 8,085
  2. Avatar for MeDon2018 162. MeDon2018 Lv 1 1 pt. 8,085
  3. Avatar for bkoep 163. bkoep Lv 1 1 pt. 8,085
  4. Avatar for Hollinas 164. Hollinas Lv 1 1 pt. 8,085

Comments