Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 7,637
  2. Avatar for Penn State Biomolecular Engineers 12. Penn State Biomolecular Engineers 1 pt. 7,046
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 0
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,573
  2. Avatar for smilingone 2. smilingone Lv 1 83 pts. 9,569
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 69 pts. 9,566
  4. Avatar for bertro 4. bertro Lv 1 56 pts. 9,564
  5. Avatar for reefyrob 5. reefyrob Lv 1 45 pts. 9,532
  6. Avatar for ManVsYard 6. ManVsYard Lv 1 36 pts. 9,525
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 29 pts. 9,522
  8. Avatar for Blipperman 8. Blipperman Lv 1 23 pts. 9,522
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 18 pts. 9,509
  10. Avatar for jeff101 10. jeff101 Lv 1 14 pts. 9,508

Comments