Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups



  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,577
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 97 pts. 9,566
  3. Avatar for actiasluna 3. actiasluna Lv 1 94 pts. 9,509
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 91 pts. 9,507
  5. Avatar for bertro 5. bertro Lv 1 88 pts. 9,476
  6. Avatar for Galaxie 6. Galaxie Lv 1 86 pts. 9,463
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 83 pts. 9,439
  8. Avatar for frood66 8. frood66 Lv 1 80 pts. 9,438
  9. Avatar for tarimo 9. tarimo Lv 1 78 pts. 9,437
  10. Avatar for Deleted player 10. Deleted player pts. 9,418

Comments