Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups



  1. Avatar for marsfan 91. marsfan Lv 1 2 pts. 8,581
  2. Avatar for SouperGenious 92. SouperGenious Lv 1 2 pts. 8,568
  3. Avatar for harvardman 93. harvardman Lv 1 2 pts. 8,539
  4. Avatar for mitarcher 94. mitarcher Lv 1 2 pts. 8,520
  5. Avatar for rinze 95. rinze Lv 1 2 pts. 8,513
  6. Avatar for silent gene 96. silent gene Lv 1 2 pts. 8,506
  7. Avatar for froggs554 97. froggs554 Lv 1 1 pt. 8,505
  8. Avatar for Arne Heessels 98. Arne Heessels Lv 1 1 pt. 8,475
  9. Avatar for multaq 99. multaq Lv 1 1 pt. 8,455
  10. Avatar for FishKAA 100. FishKAA Lv 1 1 pt. 8,445

Comments