Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 7,637
  2. Avatar for Penn State Biomolecular Engineers 12. Penn State Biomolecular Engineers 1 pt. 7,046
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 0
  1. Avatar for parsnip 111. parsnip Lv 1 1 pt. 8,127
  2. Avatar for Sydefecks 112. Sydefecks Lv 1 1 pt. 8,076
  3. Avatar for Superphosphate 113. Superphosphate Lv 1 1 pt. 7,996
  4. Avatar for antibot215 114. antibot215 Lv 1 1 pt. 7,905
  5. Avatar for nellasdim 115. nellasdim Lv 1 1 pt. 7,902
  6. Avatar for JBull 116. JBull Lv 1 1 pt. 7,787
  7. Avatar for Anton Trikshev 117. Anton Trikshev Lv 1 1 pt. 7,753
  8. Avatar for kolevkk 118. kolevkk Lv 1 1 pt. 7,717
  9. Avatar for Susume 119. Susume Lv 1 1 pt. 7,701
  10. Avatar for demeter900 120. demeter900 Lv 1 1 pt. 7,683

Comments