Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups



  1. Avatar for jamiexq 121. jamiexq Lv 1 1 pt. 7,671
  2. Avatar for alyssa_d 122. alyssa_d Lv 1 1 pt. 7,637
  3. Avatar for Graham MF 123. Graham MF Lv 1 1 pt. 7,595
  4. Avatar for gstelle 124. gstelle Lv 1 1 pt. 7,439
  5. Avatar for bzipitidoo 125. bzipitidoo Lv 1 1 pt. 7,421
  6. Avatar for SaintNick 126. SaintNick Lv 1 1 pt. 7,386
  7. Avatar for Merf 127. Merf Lv 1 1 pt. 7,264
  8. Avatar for rezaefar 128. rezaefar Lv 1 1 pt. 7,262
  9. Avatar for srinaldi1656 129. srinaldi1656 Lv 1 1 pt. 7,256
  10. Avatar for Winnr 130. Winnr Lv 1 1 pt. 7,255

Comments