Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 7,637
  2. Avatar for Penn State Biomolecular Engineers 12. Penn State Biomolecular Engineers 1 pt. 7,046
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 0
  1. Avatar for frostschutz 141. frostschutz Lv 1 1 pt. 6,369
  2. Avatar for C o n s u m e 142. C o n s u m e Lv 1 1 pt. 6,326
  3. Avatar for pandapharmd 143. pandapharmd Lv 1 1 pt. 6,193
  4. Avatar for JasonHellums 144. JasonHellums Lv 1 1 pt. 6,187
  5. Avatar for linehankai2 145. linehankai2 Lv 1 1 pt. 6,182
  6. Avatar for Wezowy 146. Wezowy Lv 1 1 pt. 6,146
  7. Avatar for sampsokc 147. sampsokc Lv 1 1 pt. 5,813
  8. Avatar for Blindsailer 148. Blindsailer Lv 1 1 pt. 5,794
  9. Avatar for AminoGang 149. AminoGang Lv 1 1 pt. 5,692
  10. Avatar for altejoh 150. altejoh Lv 1 1 pt. 3,531

Comments