Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 7,637
  2. Avatar for Penn State Biomolecular Engineers 12. Penn State Biomolecular Engineers 1 pt. 7,046
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 0
  1. Avatar for nicobul 31. nicobul Lv 1 35 pts. 9,253
  2. Avatar for smilingone 32. smilingone Lv 1 34 pts. 9,249
  3. Avatar for eusair 33. eusair Lv 1 33 pts. 9,248
  4. Avatar for spvincent 34. spvincent Lv 1 31 pts. 9,244
  5. Avatar for Museka 35. Museka Lv 1 30 pts. 9,239
  6. Avatar for ComputerMage 36. ComputerMage Lv 1 29 pts. 9,231
  7. Avatar for alcor29 37. alcor29 Lv 1 28 pts. 9,219
  8. Avatar for gmn 38. gmn Lv 1 27 pts. 9,199
  9. Avatar for dizzywings 39. dizzywings Lv 1 26 pts. 9,193
  10. Avatar for johnmitch 40. johnmitch Lv 1 25 pts. 9,191

Comments