Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 7,637
  2. Avatar for Penn State Biomolecular Engineers 12. Penn State Biomolecular Engineers 1 pt. 7,046
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 0
  1. Avatar for heather-1 41. heather-1 Lv 1 24 pts. 9,180
  2. Avatar for Blipperman 42. Blipperman Lv 1 23 pts. 9,169
  3. Avatar for DoctorSockrates 43. DoctorSockrates Lv 1 22 pts. 9,164
  4. Avatar for alwen 44. alwen Lv 1 21 pts. 9,154
  5. Avatar for TastyMunchies 45. TastyMunchies Lv 1 20 pts. 9,152
  6. Avatar for NinjaGreg 46. NinjaGreg Lv 1 19 pts. 9,144
  7. Avatar for caglar 47. caglar Lv 1 18 pts. 9,128
  8. Avatar for mberna00 48. mberna00 Lv 1 18 pts. 9,127
  9. Avatar for Anfinsen_slept_here 49. Anfinsen_slept_here Lv 1 17 pts. 9,123
  10. Avatar for isaksson 50. isaksson Lv 1 16 pts. 9,122

Comments