Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups



  1. Avatar for WBarme1234 51. WBarme1234 Lv 1 15 pts. 9,104
  2. Avatar for jobo0502 52. jobo0502 Lv 1 15 pts. 9,091
  3. Avatar for pfeiffelfloyd 53. pfeiffelfloyd Lv 1 14 pts. 9,075
  4. Avatar for Threeoak 54. Threeoak Lv 1 13 pts. 9,067
  5. Avatar for Bautho 55. Bautho Lv 1 13 pts. 9,049
  6. Avatar for manu8170 56. manu8170 Lv 1 12 pts. 9,045
  7. Avatar for jeff101 57. jeff101 Lv 1 12 pts. 9,034
  8. Avatar for YGK 58. YGK Lv 1 11 pts. 9,033
  9. Avatar for drjr 59. drjr Lv 1 11 pts. 9,023
  10. Avatar for Deleted player 60. Deleted player pts. 9,013

Comments