Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,573
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,525
  3. Avatar for Go Science 3. Go Science 41 pts. 9,509
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 9,465
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,438
  6. Avatar for Contenders 6. Contenders 7 pts. 9,344
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,308
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,269
  9. Avatar for Russian team 9. Russian team 1 pt. 9,231
  10. Avatar for freefolder 10. freefolder 1 pt. 8,956
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,573
  2. Avatar for smilingone 2. smilingone Lv 1 83 pts. 9,569
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 69 pts. 9,566
  4. Avatar for bertro 4. bertro Lv 1 56 pts. 9,564
  5. Avatar for reefyrob 5. reefyrob Lv 1 45 pts. 9,532
  6. Avatar for ManVsYard 6. ManVsYard Lv 1 36 pts. 9,525
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 29 pts. 9,522
  8. Avatar for Blipperman 8. Blipperman Lv 1 23 pts. 9,522
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 18 pts. 9,509
  10. Avatar for jeff101 10. jeff101 Lv 1 14 pts. 9,508

Comments