Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,573
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,525
  3. Avatar for Go Science 3. Go Science 41 pts. 9,509
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 9,465
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,438
  6. Avatar for Contenders 6. Contenders 7 pts. 9,344
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,308
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,269
  9. Avatar for Russian team 9. Russian team 1 pt. 9,231
  10. Avatar for freefolder 10. freefolder 1 pt. 8,956
  1. Avatar for toshiue 11. toshiue Lv 1 10 pts. 9,507
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 8 pts. 9,504
  3. Avatar for Sissue 13. Sissue Lv 1 6 pts. 9,504
  4. Avatar for Hollinas 14. Hollinas Lv 1 4 pts. 9,501
  5. Avatar for ViJay7019 15. ViJay7019 Lv 1 3 pts. 9,493
  6. Avatar for Deleted player 16. Deleted player pts. 9,468
  7. Avatar for Galaxie 17. Galaxie Lv 1 2 pts. 9,465
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 1 pt. 9,464
  9. Avatar for Maerlyn138 19. Maerlyn138 Lv 1 1 pt. 9,458
  10. Avatar for tokens 20. tokens Lv 1 1 pt. 9,457

Comments