Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for freefolder 11. freefolder 2 pts. 9,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,839
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,652
  4. Avatar for Eastern Prehistoric Force 14. Eastern Prehistoric Force 1 pt. 8,424
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,767
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 7,660
  7. Avatar for Coastal Biochemistry 17. Coastal Biochemistry 1 pt. 7,217
  8. Avatar for Window Group 18. Window Group 1 pt. 4,116
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 10,703
  2. Avatar for LociOiling 2. LociOiling Lv 1 79 pts. 10,684
  3. Avatar for bertro 3. bertro Lv 1 61 pts. 10,675
  4. Avatar for reefyrob 4. reefyrob Lv 1 47 pts. 10,672
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 35 pts. 10,658
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 26 pts. 10,615
  7. Avatar for Maerlyn138 7. Maerlyn138 Lv 1 19 pts. 10,606
  8. Avatar for toshiue 8. toshiue Lv 1 14 pts. 10,605
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 10 pts. 10,594
  10. Avatar for Anfinsen_slept_here 10. Anfinsen_slept_here Lv 1 7 pts. 10,576

Comments