Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for freefolder 11. freefolder 2 pts. 9,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,839
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,652
  4. Avatar for Eastern Prehistoric Force 14. Eastern Prehistoric Force 1 pt. 8,424
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,767
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 7,660
  7. Avatar for Coastal Biochemistry 17. Coastal Biochemistry 1 pt. 7,217
  8. Avatar for Window Group 18. Window Group 1 pt. 4,116
  1. Avatar for SaraL 101. SaraL Lv 1 1 pt. 8,535
  2. Avatar for Jrothenberg 102. Jrothenberg Lv 1 1 pt. 8,487
  3. Avatar for jamiexq 103. jamiexq Lv 1 1 pt. 8,455
  4. Avatar for ghiggins 104. ghiggins Lv 1 1 pt. 8,437
  5. Avatar for alyssajoyh 105. alyssajoyh Lv 1 1 pt. 8,435
  6. Avatar for wuhongzei 106. wuhongzei Lv 1 1 pt. 8,424
  7. Avatar for abiogenesis 107. abiogenesis Lv 1 1 pt. 8,371
  8. Avatar for bergie72 108. bergie72 Lv 1 1 pt. 8,286
  9. Avatar for nicobul 109. nicobul Lv 1 1 pt. 8,189
  10. Avatar for RainerGewalt 110. RainerGewalt Lv 1 1 pt. 8,189

Comments