Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for freefolder 11. freefolder 2 pts. 9,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,839
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,652
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,767
  5. Avatar for Czech National Team 16. Czech National Team 1 pt. 7,660
  6. Avatar for Coastal Biochemistry 17. Coastal Biochemistry 1 pt. 7,217
  7. Avatar for Window Group 18. Window Group 1 pt. 4,116

  1. Avatar for A Manatee 131. A Manatee Lv 1 1 pt. 7,569
  2. Avatar for mashasuperstar 132. mashasuperstar Lv 1 1 pt. 7,541
  3. Avatar for leehaggis 133. leehaggis Lv 1 1 pt. 7,502
  4. Avatar for parsnip 134. parsnip Lv 1 1 pt. 7,494
  5. Avatar for pepekovic 135. pepekovic Lv 1 1 pt. 7,494
  6. Avatar for NausheenBhat 136. NausheenBhat Lv 1 1 pt. 7,448
  7. Avatar for captainkid 137. captainkid Lv 1 1 pt. 7,413
  8. Avatar for shiningstar1 138. shiningstar1 Lv 1 1 pt. 7,408
  9. Avatar for calgone 139. calgone Lv 1 1 pt. 7,373
  10. Avatar for nofikanomusic 140. nofikanomusic Lv 1 1 pt. 7,335

Comments