Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for freefolder 11. freefolder 2 pts. 9,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,839
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,652
  4. Avatar for Eastern Prehistoric Force 14. Eastern Prehistoric Force 1 pt. 8,424
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,767
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 7,660
  7. Avatar for Coastal Biochemistry 17. Coastal Biochemistry 1 pt. 7,217
  8. Avatar for Window Group 18. Window Group 1 pt. 4,116
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 73 pts. 10,480
  2. Avatar for Enzyme 12. Enzyme Lv 1 71 pts. 10,430
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 69 pts. 10,420
  4. Avatar for Galaxie 14. Galaxie Lv 1 66 pts. 10,347
  5. Avatar for Anfinsen_slept_here 15. Anfinsen_slept_here Lv 1 64 pts. 10,344
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 62 pts. 10,335
  7. Avatar for grogar7 17. grogar7 Lv 1 60 pts. 10,330
  8. Avatar for guineapig 18. guineapig Lv 1 58 pts. 10,326
  9. Avatar for Deleted player 19. Deleted player pts. 10,313
  10. Avatar for actiasluna 20. actiasluna Lv 1 54 pts. 10,282

Comments