Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for freefolder 11. freefolder 2 pts. 9,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,839
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,652
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,767
  5. Avatar for Czech National Team 16. Czech National Team 1 pt. 7,660
  6. Avatar for Coastal Biochemistry 17. Coastal Biochemistry 1 pt. 7,217
  7. Avatar for Window Group 18. Window Group 1 pt. 4,116

  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 52 pts. 10,271
  2. Avatar for Blipperman 22. Blipperman Lv 1 50 pts. 10,249
  3. Avatar for dizzywings 23. dizzywings Lv 1 49 pts. 10,221
  4. Avatar for eusair 24. eusair Lv 1 47 pts. 10,209
  5. Avatar for caglar 25. caglar Lv 1 45 pts. 10,207
  6. Avatar for robgee 26. robgee Lv 1 44 pts. 10,185
  7. Avatar for O Seki To 27. O Seki To Lv 1 42 pts. 10,156
  8. Avatar for pvc78 28. pvc78 Lv 1 41 pts. 10,152
  9. Avatar for georg137 29. georg137 Lv 1 39 pts. 10,145
  10. Avatar for Maerlyn138 30. Maerlyn138 Lv 1 38 pts. 10,142

Comments