Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for freefolder 11. freefolder 2 pts. 9,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,839
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,652
  4. Avatar for Eastern Prehistoric Force 14. Eastern Prehistoric Force 1 pt. 8,424
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,767
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 7,660
  7. Avatar for Coastal Biochemistry 17. Coastal Biochemistry 1 pt. 7,217
  8. Avatar for Window Group 18. Window Group 1 pt. 4,116
  1. Avatar for amphi341441 71. amphi341441 Lv 1 6 pts. 9,134
  2. Avatar for ViJay7019 72. ViJay7019 Lv 1 6 pts. 9,129
  3. Avatar for SouperGenious 73. SouperGenious Lv 1 6 pts. 9,105
  4. Avatar for YeshuaLives 74. YeshuaLives Lv 1 6 pts. 9,077
  5. Avatar for pfeiffelfloyd 75. pfeiffelfloyd Lv 1 5 pts. 9,075
  6. Avatar for Altercomp 76. Altercomp Lv 1 5 pts. 9,070
  7. Avatar for isaksson 77. isaksson Lv 1 5 pts. 9,050
  8. Avatar for altejoh 78. altejoh Lv 1 4 pts. 8,967
  9. Avatar for momadoc 79. momadoc Lv 1 4 pts. 8,965
  10. Avatar for Arne Heessels 80. Arne Heessels Lv 1 4 pts. 8,925

Comments