Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for freefolder 11. freefolder 2 pts. 9,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,839
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,652
  4. Avatar for Eastern Prehistoric Force 14. Eastern Prehistoric Force 1 pt. 8,424
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,767
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 7,660
  7. Avatar for Coastal Biochemistry 17. Coastal Biochemistry 1 pt. 7,217
  8. Avatar for Window Group 18. Window Group 1 pt. 4,116
  1. Avatar for rinze 81. rinze Lv 1 4 pts. 8,895
  2. Avatar for Noodle Soup 82. Noodle Soup Lv 1 4 pts. 8,890
  3. Avatar for harvardman 83. harvardman Lv 1 3 pts. 8,873
  4. Avatar for Jayadev 84. Jayadev Lv 1 3 pts. 8,866
  5. Avatar for rabamino12358 85. rabamino12358 Lv 1 3 pts. 8,856
  6. Avatar for SKSbell 86. SKSbell Lv 1 3 pts. 8,856
  7. Avatar for toshiue 87. toshiue Lv 1 3 pts. 8,844
  8. Avatar for aendgraend 88. aendgraend Lv 1 3 pts. 8,839
  9. Avatar for multaq 89. multaq Lv 1 2 pts. 8,764
  10. Avatar for cherry39 90. cherry39 Lv 1 2 pts. 8,761

Comments