Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,707
  2. Avatar for Go Science 2. Go Science 74 pts. 10,647
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,603
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,542
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 10,430
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 18 pts. 10,347
  7. Avatar for Contenders 7. Contenders 12 pts. 10,335
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,317
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,156
  10. Avatar for Deleted group 10. Deleted group pts. 9,146

  1. Avatar for sciencewalker 11. sciencewalker Lv 1 4 pts. 10,572
  2. Avatar for Hollinas 12. Hollinas Lv 1 3 pts. 10,571
  3. Avatar for ViJay7019 13. ViJay7019 Lv 1 2 pts. 10,555
  4. Avatar for jausmh 14. jausmh Lv 1 1 pt. 10,542
  5. Avatar for Galaxie 15. Galaxie Lv 1 1 pt. 10,346
  6. Avatar for nicobul 16. nicobul Lv 1 1 pt. 10,317
  7. Avatar for alwen 17. alwen Lv 1 1 pt. 10,307
  8. Avatar for Deleted player 18. Deleted player pts. 10,305
  9. Avatar for alcor29 19. alcor29 Lv 1 1 pt. 10,304
  10. Avatar for Alistair69 20. Alistair69 Lv 1 1 pt. 10,234

Comments